PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010651-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 313aa    MW: 35064.3 Da    PI: 7.7504
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010651-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.3e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l d++k +G g+W+  +++ g++R++k+c++rw++yl
    NNU_010651-RA 14 RGAWTALEDKILTDYIKVHGEGRWRNLPKKAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding50.26e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T +E++l+v+++++lG++ W++Ia +++ gRt++++k++w++ 
    NNU_010651-RA  67 RGNITRDEEDLIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.187961IPR017930Myb domain
SuperFamilySSF466892.89E-2712108IPR009057Homeodomain-like
SMARTSM007178.2E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-131461IPR001005SANT/Myb domain
CDDcd001671.33E-91661No hitNo description
PROSITE profilePS5129424.75662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2365116IPR009057Homeodomain-like
SMARTSM007175.8E-1566114IPR001005SANT/Myb domain
PfamPF002494.2E-1467112IPR001005SANT/Myb domain
CDDcd001675.09E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGRSPCCAKE GLNRGAWTAL EDKILTDYIK VHGEGRWRNL PKKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI TRDEEDLIVR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT NLGKKVQAHT  120
TTIFTGTKKK TTTTTSTKNI RAVESPPIPK LESRVVRTKA FRCSKVFLGP PQNKMEQHTD  180
NDAMALASKV GNFSTQKALV SESYDGQSSF TPEKENGISL DFTVNLNPGE LFLSELLNSD  240
FSQLGDFDDG LVGEVSNDEN NNNNDSSPSS DQPPFFPDEL FEWKGSDCGQ SDVISDLRSL  300
ASFLDCGENW LAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261929.10.0PREDICTED: myb-related protein Myb4
TrEMBLA0A061GMC61e-109A0A061GMC6_THECC; GHMYB10, putative
STRINGVIT_11s0016g01300.t011e-101(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.13e-61myb domain protein 3